Protein Info for OKFHMN_18435 in Escherichia coli ECRC100
Name: yhaM
Annotation: UPF0597 protein YhaM
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to YHAM_ECO5E: UPF0597 protein YhaM (yhaM) from Escherichia coli O157:H7 (strain EC4115 / EHEC)
KEGG orthology group: None (inferred from 100% identity to eco:b4470)MetaCyc: 100% identical to L-cysteine desulfidase (Escherichia coli K-12 substr. MG1655)
Cystathionine gamma-lyase. [EC: 4.4.1.1, 4.4.1.28]
Predicted SEED Role
"Inner membrane protein"
MetaCyc Pathways
- superpathway of branched chain amino acid biosynthesis (17/17 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- superpathway of L-threonine metabolism (15/18 steps found)
- L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
- L-threonine degradation I (6/6 steps found)
- D-serine degradation (3/3 steps found)
- L-serine degradation (3/3 steps found)
- L-tryptophan degradation II (via pyruvate) (3/3 steps found)
- L-methionine biosynthesis II (5/6 steps found)
- L-cysteine degradation II (2/3 steps found)
- L-methionine degradation II (2/3 steps found)
- purine nucleobases degradation II (anaerobic) (17/24 steps found)
- homocysteine and cysteine interconversion (2/4 steps found)
- L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
- glycine betaine degradation III (4/7 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)
- felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
- L-mimosine degradation (4/8 steps found)
- glycine betaine degradation I (4/8 steps found)
- superpathway of L-cysteine biosynthesis (fungi) (2/6 steps found)
- superpathway of L-cysteine biosynthesis (mammalian) (1/5 steps found)
- glutathione-mediated detoxification I (3/8 steps found)
- hydrogen sulfide biosynthesis II (mammalian) (1/6 steps found)
- hypoglycin biosynthesis (4/14 steps found)
- superpathway of L-methionine salvage and degradation (5/16 steps found)
KEGG Metabolic Maps
- Cysteine metabolism
- Glycine, serine and threonine metabolism
- Methionine metabolism
- Nitrogen metabolism
- Selenoamino acid metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.4.1.1 or 4.4.1.28
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (436 amino acids)
>OKFHMN_18435 UPF0597 protein YhaM (Escherichia coli ECRC100) MFDSTLNPLWQRYILAVQEEVKPALGCTEPISLALAAAVAAAELEGPVERVEAWVSPNLM KNGLGVTVPGTGMVGLPIAAALGALGGNANAGLEVLKDATAQAIADAKALLAAGKVSVKI QEPCNEILFSRAKVWNGEKWACVTIVGGHTNIVHIETHDGVVFTQQACVAEGEQESPLSV LSRTTLAEILKFVNEVPFAAIRFILDSAKLNCALSQEGLSGKWGLHIGATLEKQCERGLL AKDLSSSIVIRTSAASDARMGGATLPAMSNSGSGNQGITATMPVVVVAEHFGADDERLAR ALMLSHLSAIYIHNQLPRLSALCAATTAAMGAAAGMAWLVDGRYETISMAISSMIGDVSG MICDGASNSCAMKVSTSASAAWKAVLMALDDTAVTGNEGIVAHDVEQSIANLCALASHSM QQTDRQIIEIMASKAR