Protein Info for OKFHMN_18295 in Escherichia coli ECRC100

Name: agaB
Annotation: PTS galactosamine transporter subunit IIB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00854: PTS system, mannose/fructose/sorbose family, IIB component" amino acids 5 to 155 (151 residues), 237.8 bits, see alignment E=2.4e-75 PF03830: PTSIIB_sorb" amino acids 6 to 153 (148 residues), 164.1 bits, see alignment E=1.4e-52

Best Hits

Swiss-Prot: 99% identical to PTPB1_ECOLI: N-acetylgalactosamine-specific phosphotransferase enzyme IIB component 1 (agaB) from Escherichia coli (strain K12)

KEGG orthology group: K10984, PTS system, galactosamine-specific IIB component [EC: 2.7.1.69] (inferred from 99% identity to eco:b3138)

MetaCyc: 100% identical to AgaB (Escherichia coli O157:H7)
TRANS-RXN-167 [EC: 2.7.1.193]

Predicted SEED Role

"PTS system, galactosamine-specific IIB component (EC 2.7.1.69)" in subsystem N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.193 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>OKFHMN_18295 PTS galactosamine transporter subunit IIB (Escherichia coli ECRC100)
MSSPNILLTRIDNRLVHGQVGVTWTSTIGANLLVVVDDVVANDDIQQKLMGITAETYGFG
IRFFTIEKTINVIGKAAPHQKIFLICRTPQTVRKLVEGGIDLKDVNVGNMHFSEGKKQIS
SKVYVDDQDLTDLRFIKQRGVNVFIQDVPGDQKEQIPD