Protein Info for OKFHMN_17390 in Escherichia coli ECRC100

Name: rpsC
Annotation: 30S ribosomal protein S3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 TIGR01009: ribosomal protein uS3" amino acids 1 to 209 (209 residues), 332.5 bits, see alignment E=5.7e-104 PF07650: KH_2" amino acids 38 to 111 (74 residues), 72.1 bits, see alignment E=2.7e-24 PF00189: Ribosomal_S3_C" amino acids 120 to 202 (83 residues), 138.9 bits, see alignment E=6.8e-45

Best Hits

Swiss-Prot: 100% identical to RS3_SALDC: 30S ribosomal protein S3 (rpsC) from Salmonella dublin (strain CT_02021853)

KEGG orthology group: K02982, small subunit ribosomal protein S3 (inferred from 100% identity to eco:b3314)

MetaCyc: 100% identical to 30S ribosomal subunit protein S3 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S3p (S3e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>OKFHMN_17390 30S ribosomal protein S3 (Escherichia coli ECRC100)
MGQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKASVSRIVIERP
AKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQINIAEVRKPELDAKLVADSI
TSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIARTEWYREGRVPLHTLRA
DIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAAQPKKQQRKGRK