Protein Info for OKFHMN_15930 in Escherichia coli ECRC100

Name: bax
Annotation: protein bax

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01832: Glucosaminidase" amino acids 143 to 267 (125 residues), 68.6 bits, see alignment E=4.2e-23

Best Hits

Swiss-Prot: 100% identical to BAX_ECOLI: Protein bax (bax) from Escherichia coli (strain K12)

KEGG orthology group: K03796, Bax protein (inferred from 100% identity to eco:b3570)

Predicted SEED Role

"BAX protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (274 amino acids)

>OKFHMN_15930 protein bax (Escherichia coli ECRC100)
MILTPIRRYGAMILMLLTLVFSSEVLAKTHTTTASQKSHLTKASNKQVSSKQEYSRNSAK
SSSLPDLRKYPSGTSRKKAFLRTVMPYITSQNAAITAERNWLISKQYQGQWSPAERARLK
DIAKRYKVKWSGNTRKIPWNTLLERVDIIPTSMVATMAAAESGWGTSKLARNNNNLFGMK
CMKGRCTNAPGKVKGYSQFSSVKESVSAYVTNLNTHPAYSSFRKSRAQLRKADQEVTATA
MIHKLKGYSTKGKSYNNYLFAMYQDNQRLIAAHM