Protein Info for OKFHMN_15680 in Escherichia coli ECRC100

Name: rfaB
Annotation: UDP-glucose--(glucosyl)LPS alpha-1,2-glucosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00534: Glycos_transf_1
  • amino acids 182 to 350 (169 residues), 119.3 bits, E=2.1e-38
• PF20706: GT4-conflict
  • amino acids 190 to 323 (134 residues), 40.2 bits, E=3.3e-14
• PF13692: Glyco_trans_1_4
  • amino acids 194 to 344 (151 residues), 84.7 bits, E=1.1e-27

Best Hits

Swiss-Prot: 57% identical to WAAK_SALTY: Lipopolysaccharide 1,2-N-acetylglucosaminetransferase (waaK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00713, UDP-glucose:(glucosyl)LPS alpha-1,2-glucosyltransferase [EC: 2.4.1.-] (inferred from 99% identity to ecq:ECED1_4309)

MetaCyc: 57% identical to lipopolysaccharide N-acetylglucosaminyltransferase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Lipopolysaccharide N-acetylglucosaminyltransferase. [EC: 2.4.1.56]

Predicted SEED Role

"Lipopolysaccharide 1,2-N-acetylglucosaminetransferase (EC 2.4.1.56)" in subsystem LOS core oligosaccharide biosynthesis (EC 2.4.1.56)

MetaCyc Pathways

• lipid A-core biosynthesis (Salmonella) (9/10 steps found)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.56

Protein Sequence (380 amino acids)

>OKFHMN_15680 UDP-glucose--(glucosyl)LPS alpha-1,2-glucosyltransferase (Escherichia coli ECRC100)
MVDKIIFTVTPIFSIPPRGAAAVETWMYQVAQRTNFPNRIVCIKNPGYSNYTFVNDNCSI
HRVGFSRIYKRLFQKWTRLDPLPYSQRILNIAHDFPITKESVIVVHNSMKLYTQIRKRAP
QARVVIHMHNAFEPKLLEQNVKMIVPSLYLKKYYQSYLANADIEIVPNGIDLETYQSNFQ
PITRSELNISPEEKIIFYAGRIVPDKGILLLMQSFEKLAAAHKNLKLVVIGDYTEMSKSD
KGAYQRNVREIAKRLKDRCIMLGSIPPEKMHCYYPLADLVVIPSQFQEPFCMVAIEAMGA
GKPVLVSTRGGMTEFVKENTTGFHLKEPMTADSISSDILKTLANPELTAVAKQGQDFVFD
HYSWDGVTQRFEEVIHNWFE