Protein Info for OKFHMN_14110 in Escherichia coli ECRC100

Name: glnG
Annotation: nitrogen regulation protein NR(I)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 TIGR01818: nitrogen regulation protein NR(I)" amino acids 6 to 466 (461 residues), 826.5 bits, see alignment E=3e-253 PF00072: Response_reg" amino acids 6 to 115 (110 residues), 110.1 bits, see alignment E=2.1e-35 PF00158: Sigma54_activat" amino acids 140 to 306 (167 residues), 242.5 bits, see alignment E=6.1e-76 PF14532: Sigma54_activ_2" amino acids 141 to 311 (171 residues), 79.7 bits, see alignment E=7.5e-26 PF07724: AAA_2" amino acids 160 to 280 (121 residues), 27.1 bits, see alignment E=1.2e-09 PF07728: AAA_5" amino acids 164 to 284 (121 residues), 32.8 bits, see alignment E=2e-11 PF02954: HTH_8" amino acids 427 to 466 (40 residues), 52.1 bits, see alignment 1.3e-17

Best Hits

Swiss-Prot: 100% identical to NTRC_ECOLI: DNA-binding transcriptional regulator NtrC (glnG) from Escherichia coli (strain K12)

KEGG orthology group: K07712, two-component system, NtrC family, nitrogen regulation response regulator GlnG (inferred from 100% identity to eco:b3868)

Predicted SEED Role

"Nitrogen regulation protein NtrC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>OKFHMN_14110 nitrogen regulation protein NR(I) (Escherichia coli ECRC100)
MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGAEVLEALASKTPDVLLSDIRMPGM
DGLALLKQIKQRHPMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAIS
HYQEQQQPRNVQLNGPTTDIIGEAPAMQDVFRIIGRLSRSSISVLINGESGTGKELVAHA
LHRHSPRAKAPFIALNMAAIPKDLIESELFGHEKGAFTGANTIRQGRFEQADGGTLFLDE
IGDMPLDVQTRLLRVLADGQFYRVGGYAPVKVDVRIIAATHQNLEQRVQEGKFREDLFHR
LNVIRVHLPPLRERREDIPRLARHFLQVAARELGVEAKLLHPETEAALTRLAWPGNVRQL
ENTCRWLTVMAAGQEVLIQDLPGELFESTVAESTSQMQPDSWATLLAQWADRALRSGHQN
LLSEAQPELERTLLTTALRHTQGHKQEAARLLGWGRNTLTRKLKELGME