Protein Info for OKFHMN_12705 in Escherichia coli ECRC100

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 756 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 292 to 312 (21 residues), see Phobius details PF00672: HAMP" amino acids 312 to 360 (49 residues), 36.3 bits, see alignment 1.2e-12 PF00512: HisKA" amino acids 402 to 461 (60 residues), 28.9 bits, see alignment 2e-10 PF02518: HATPase_c" amino acids 504 to 619 (116 residues), 78.5 bits, see alignment E=1e-25 PF00072: Response_reg" amino acids 643 to 752 (110 residues), 41.3 bits, see alignment E=3.1e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_5603)

Predicted SEED Role

"Two-component system sensor protein Z5692"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (756 amino acids)

>OKFHMN_12705 hybrid sensor histidine kinase/response regulator (Escherichia coli ECRC100)
MAHPGRHFFASARGRLLLLNLLVVAVTLMVSGVAVMGFRHASQMQELVQQQTVDDMTGSL
NLARDTANVATAAVRLSQVVGALEYKGEAERLQETQRALKSSLAQLANAPLAQQEAGLVT
RIITRSNELQTSVGGMLERGQRRHLERNALLSSLYQNLSYLRHLQKVTHAQDDILLNEMN
RLIVAAIATPAPQAIIHQLVGVMSALPTHSDTPLVNTLLNDFNDFNDEMRKLAPLSAALE
QSDLAISWYMFHIKALVAILNGDINRYAEQVATLSGQRVAQSYQDLRSGERVIMIFALLA
VVITAFAGWYIYRNLGTNLTAISRAMSRLAHGEADVTFPALQRRDELGELARAFNVFARN
TASLERTSRLLKEKTTQMEIAQTERQGLEEALLHSQKLKAVGQLTGGLAHDFNNLLAVII
GSLELVNPDSPDAPRIQRALQAAERGALLTQRLLAFSRKQSLHPQAVELKTLLEELSELM
RHSLPATLALEIEAQSPAWPAWIDISQLENAIINLVMNARDAMEGQTGIIKIRTWNQRVT
RSSGQRQDMVALEVIDHGCGMSQAVKSQVFEPFFTTKQTGSGSGLGLSMVYGFVRQSGGR
VEIESAPGQGTTVRLQLPRALTAAKNLSPAAVEQASVSGDKLVLVLEDEAAVRQTICEQL
HLLGYLTLEASSGEQALDLLAASAEIDIFISDLMLPGGMSGAEVVNAARKLYPHLTLLLI
SGQDLRPSHNPALPDVALLRKPFTRAQLAQALGQEN