Protein Info for OKFHMN_12265 in Escherichia coli ECRC100

Name: mutL
Annotation: DNA mismatch repair endonuclease MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 TIGR00585: DNA mismatch repair protein MutL" amino acids 1 to 311 (311 residues), 357.6 bits, see alignment E=3.9e-111 PF02518: HATPase_c" amino acids 21 to 77 (57 residues), 32.9 bits, see alignment 1.5e-11 PF13589: HATPase_c_3" amino acids 24 to 120 (97 residues), 50.9 bits, see alignment E=3.4e-17 PF01119: DNA_mis_repair" amino acids 214 to 330 (117 residues), 125.5 bits, see alignment E=1.8e-40 PF08676: MutL_C" amino acids 440 to 564 (125 residues), 83.8 bits, see alignment E=2e-27

Best Hits

Swiss-Prot: 100% identical to MUTL_ECO5E: DNA mismatch repair protein MutL (mutL) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 99% identity to eck:EC55989_4725)

MetaCyc: 99% identical to DNA mismatch repair protein MutL (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (615 amino acids)

>OKFHMN_12265 DNA mismatch repair endonuclease MutL (Escherichia coli ECRC100)
MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDIDIERGGAKLIRIRDNG
CGIKKDELALALARHATSKIASLDDLEAIISLGFRGEALASISSVSRLTLTSRTAEQQEA
WQAYAEGRDMDVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRTEKTEFNHIDEIIRRIAL
ARFDVTINLSHNGKIVRQYRAVPEGGQKERRLGAICGTAFLEQALAIEWQHGDLTLRGWV
ADPNHTTPALAEIQYCYVNGRMMRDRLINHAIRQACEDKLGADQQPAFVLYLEIDPHQVD
VNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQQQLETPLPLDDEPQPAPRPIPENRVAAGR
NHFAEPAVREPVAPRYTPAPASGSRPAAPWPNAQPGYQKQQGEVYRQLLQTPAPMQKPKA
PEPQEPALAANSQSFGRVLTIVHSDCALLERDGNISLLALPVAERWLRQVQLTPGEAPVC
AQPLLIPLRLKVSGEEKSALEKAQSALAELGIDFQSDAQHVTIRAVPLPLRQQNLQILIP
ELIGYLAKQSVFEPGNIAQWIARNLMSEHAQWSMAQAITLLADVERLCPQLVKTPPGGLL
QSVDLHPAIKALKDE