Protein Info for OKFHMN_09205 in Escherichia coli ECRC100

Name: ykgK,ecpR
Annotation: regulator protein EcpR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF27348: EcpR_N" amino acids 3 to 112 (110 residues), 73.9 bits, see alignment E=1.2e-24 PF00196: GerE" amino acids 129 to 171 (43 residues), 40.3 bits, see alignment 2e-14

Best Hits

Swiss-Prot: 100% identical to ECPR_ECO57: HTH-type transcriptional regulator EcpR (ecpR) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 97% identity to eco:b0294)

Predicted SEED Role

"FIGfam014588: Predicted regulator of CFA/I fimbriae"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>OKFHMN_09205 regulator protein EcpR (Escherichia coli ECRC100)
MECQNRSDKYIWSPHDAYFYKGLSELIVDIDRLIYLSLEKIRKDFVFINLNTDSLTEFIN
RDNEWLSAVKGKQVVLIAARKSEALANYWYYNSNIRGVVYAGLSRDIRKELAYVINGRFL
RKDIKKDKITDREMEIIRMTAQGMLPKSIARIENCSVKTVYTHRRNAEAKLYSKLYKLVQ