Protein Info for OKFHMN_01650 in Escherichia coli ECRC100

Name: ydcJ
Annotation: Uncharacterized protein YdcJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF07063: HGLS" amino acids 14 to 400 (387 residues), 535.2 bits, see alignment E=6e-165

Best Hits

Swiss-Prot: 99% identical to YDCJ_ECOLI: Uncharacterized protein YdcJ (ydcJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_2028)

Predicted SEED Role

"FIG074102: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>OKFHMN_01650 Uncharacterized protein YdcJ (Escherichia coli ECRC100)
MANSITADEIREQFSQAMSAMYQQEVPQYGTLLELVADVNLAVLENNPQLHEKMVNADEL
ARLNVERHGAIRVGTAQELATLRRMFAIMGMYPVSYYDLSQAGVPVHSTAFRPIDDASLA
RNPFRVFTSLLRLELIENEILRQKAAEILRQRDIFTPRCRQLLEEYDQRGGFNETQAQEF
VQEALETFRWHQSATVDEETYRALHNEHRLIADVVCFPGCHINHLTPRTLDIDRVQSMMP
ECGIEPKILIEGPPRREVPILLRQTSFKALEETVLFAGQKQGTHTARFGEIEQRGVALTP
KGRQLYDDLLRNAGTGQDNLTHQMHLQETFRTFPDSEFLMRQQGLAWFRYRLTPSGEAHR
QAIHPGDDPQPLIERGWVAAQPITYEDFLPVSAAGIFQSNLGNETQARSHGNASREAFEQ
ALGCPVLDEFQLYQEAEERSKRRCGLL