Protein Info for OKFHMN_01495 in Escherichia coli ECRC100

Name: vgrG,tssI
Annotation: type VI secretion system effector VgrG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 702 TIGR03361: type VI secretion system Vgr family protein" amino acids 7 to 517 (511 residues), 626.2 bits, see alignment E=4.1e-192 TIGR01646: Rhs element Vgr protein" amino acids 20 to 500 (481 residues), 443.8 bits, see alignment E=8.7e-137 PF05954: Phage_GPD" amino acids 29 to 327 (299 residues), 245.6 bits, see alignment E=1e-76 PF04717: Phage_base_V" amino acids 384 to 450 (67 residues), 55.4 bits, see alignment E=9.5e-19 PF22178: Gp5_trimer_C" amino acids 468 to 576 (109 residues), 89.4 bits, see alignment E=2.8e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_2064)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (702 amino acids)

>OKFHMN_01495 type VI secretion system effector VgrG (Escherichia coli ECRC100)
MSTGLRFTLEVDGLPPDAFAVVSFHLNQSLSSLFSLDLSLVSQQFLSLEFAQVLDKMAYL
TVWQGDDVQRRVKGVVTWFELGENDKNQMLYSMKVCPPLWRTGLRQNFRIFQNEDIESIL
ATILKENGVTEWSPLFSEPHPSREFCVQYGETDYDFLCRMAAEEGIFFYEEHAQKSIDQS
LVLCDTVRYLPESFEIPWNPNTRTEVSTLCISQFRYSAQIRPSSVVTKDYTFKRPGWAGR
FDQEGQYQDYQRTQYEVYDYPGRFKGAHGQNFARWQMDGWRNNAEVARGTSRSPEIWPGR
RIVLTGHPQANLNREWQVVASELHGEQPQAVPGRRGSGTTLNNHFAVIPADRTWRPQPLL
KPLVDGPQSAVVTGPAGEEIFCDEHGRVRVKFNWDRYNPSNQDSSCWIRVAQAWAGTGFG
NLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHQENRTPGSLPGTKTQMTIRSKNYKGSGFN
ELKFDDATGKEQVYIHAQKNMNTEVLNNRTTDVINNHAETIGNNQMIAVTNNQIQTVGVN
QIETVGSNQIINVGSVQVETIGLVRALTVGVAYQTTVGGIMNTSVALMQSSQIGLHKSLR
VGLGYDVKVGNNVTFTVGKTKKDDTGQTAIYSAGEHLELCCGKARLVLTKDGQIFLNGTK
IHLQGKEQVNGDSLLINWNCAASKSPPKTPDEKQDTPDMREY