Protein Info for OHPLBJKB_04101 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: PTS system mannose-specific EIIBCA component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details amino acids 201 to 228 (28 residues), see Phobius details amino acids 250 to 269 (20 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details amino acids 314 to 334 (21 residues), see Phobius details TIGR01427: PTS system, Fru family, IIC component" amino acids 10 to 335 (326 residues), 300.8 bits, see alignment E=7.9e-94

Best Hits

Swiss-Prot: 100% identical to PTFC2_ECOLI: Fructose-like permease IIC component 2 (frwC) from Escherichia coli (strain K12)

KEGG orthology group: K11203, PTS system, fructose-specific IIC-like component (inferred from 100% identity to eco:b3949)

MetaCyc: 100% identical to putative PTS enzyme IIC component FrwC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, fructose-specific IIC component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>OHPLBJKB_04101 PTS system mannose-specific EIIBCA component (Escherichia coli HS(pFamp)R (ATCC 700891))
MNELVQILKNTRQHLMTGVSHMIPFVVSGGILLAVSVMLYGKGAVPDAVADPNLKKLFDI
GVAGLTLMVPFLAAYIGYSIAERSALAPCAIGAWVGNSFGAGFFGALIAGIIGGIVVHYL
KKIPVHKVLRSVMPIFIIPIVGTLITAGIMMWGLGEPVGALTNSLTQWLQGMQQGSIVML
AVIMGLMLAFDMGGPVNKVAYAFMLICVAQGVYTVVAIAAVGICVPPLGMGLATLIGRKN
FSAEERETGKAALVMGCVGVTEGAIPFAAADPLRVIPSIMVGSVCGAVTAALVGAQCYAG
WGGLIVLPVVEGKLGYIAAVAVGAVVTAVCVNVLKSLARKNGSSTDEKEDDLDLDFEIN