Protein Info for OHPLBJKB_03728 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Multidrug resistance protein MdtM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 68 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 216 to 238 (23 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 283 to 304 (22 residues), see Phobius details amino acids 309 to 333 (25 residues), see Phobius details amino acids 347 to 368 (22 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 353 (331 residues), 113.7 bits, see alignment E=9.3e-37 PF00083: Sugar_tr" amino acids 48 to 209 (162 residues), 35.9 bits, see alignment E=4.4e-13

Best Hits

Swiss-Prot: 99% identical to MDTM_ECO57: Multidrug resistance protein MdtM (mdtM) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to eoh:ECO103_5119)

MetaCyc: 98% identical to multidrug efflux pump / bile salt:H+ antiporter / Na+:H+ antiporter / K+:H+ antiporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-129; TRANS-RXN-336; TRANS-RXN-44; TRANS-RXN0-588; TRANS-RXN0-589

Predicted SEED Role

"FIG00637933: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (410 amino acids)

>OHPLBJKB_03728 Multidrug resistance protein MdtM (Escherichia coli HS(pFamp)R (ATCC 700891))
MPRFFARHAATLFFPMALILYDFAAYLSTDLIQPGIINVVRDFNADVSLAPAAVSLYLAG
GMALQWLLGPLSDRIGRRPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIAT
VGYVTVQEAFGQTKGIKLMAIITSIVLIAPIIGPLSGAALMHFVHWKVLFAIIAVMGFIS
FVGLLLAMPETVKRGAVPFSAKSVLRDFRNVFCNRLFLFGATTISLSYIPMMSWVAVSPV
ILIDAGGLTTSQFAWTQVPVFGAVIVANAIVARFVKDPTEPRFIWRAVPIQLVGLALLII
GNLLSPHVWLWSVLGTSLYAFGIGLIFPTLFRFTLFSNNLPKGTVSASLNMVILMVMSVS
VEIGRWLWFNGGRLPFHLLAVVAGIIVVFTLAGLLNRVRQHQAAELAEER