Protein Info for OHPLBJKB_03687 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Peptide chain release factor RF3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 538 TIGR00503: peptide chain release factor 3" amino acids 12 to 538 (527 residues), 1096 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 22 to 286 (265 residues), 163 bits, see alignment E=1.3e-51 TIGR00231: small GTP-binding protein domain" amino acids 24 to 165 (142 residues), 65 bits, see alignment E=7e-22 PF01926: MMR_HSR1" amino acids 26 to 152 (127 residues), 22.9 bits, see alignment E=1.6e-08 PF03144: GTP_EFTU_D2" amino acids 323 to 389 (67 residues), 50.4 bits, see alignment E=5e-17 PF16658: RF3_C" amino acids 396 to 523 (128 residues), 159.5 bits, see alignment E=7.9e-51

Best Hits

Swiss-Prot: 100% identical to RF3_SHIB3: Peptide chain release factor 3 (prfC) from Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 100% identity to ecp:ECP_4758)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (538 amino acids)

>OHPLBJKB_03687 Peptide chain release factor RF3 (Escherichia coli HS(pFamp)R (ATCC 700891))
MPLTQEERIMTLSPYLQEVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQTAGTVKGRGS
NQHAKSDWMEMEKQRGISITTSVMQFPYHDCLVNLLDTPGHEDFSEDTYRTLTAVDCCLM
VIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVENELKIGCAPITW
PIGCGKLFKGVYHLYKDETYLYQSGKGHTIQEVRIVKGLNNPDLDAAVGEDLAQQLRDEL
ELVKGASNEFDKELFLAGEITPVFFGTALGNFGVDHMLDGLVEWAPAPMPRQTDTRTVEA
SEDKFTGFVFKIQANMDPKHRDRVAFMRVVSGKYEKGMKLRQVRTAKDVVISDALTFMAG
DRSHVEEAYPGDILGLHNHGTIQIGDTFTQGEMMKFTGIPNFAPELFRRIRLKDPLKQKQ
LLKGLVQLSEEGAVQVFRPISNNDLIVGAVGVLQFDVVVSRLKSEYNVEAVYESVNVATA
RWVECADAKKFEEFKRKNESQLALDGGDNLAYIATSMVNLRLAQERYPDVQFHQTREH