Protein Info for OHPLBJKB_03250 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 PF04461: YajQ" amino acids 2 to 162 (161 residues), 217.8 bits, see alignment E=4.8e-69

Best Hits

Swiss-Prot: 100% identical to YAJQ_SHISS: UPF0234 protein YajQ (yajQ) from Shigella sonnei (strain Ss046)

KEGG orthology group: K09767, hypothetical protein (inferred from 100% identity to eco:b0426)

Predicted SEED Role

"FIG001943: hypothetical protein YajQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (163 amino acids)

>OHPLBJKB_03250 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MPSFDIVSEVDLQEARNAVDNASREVESRFDFRNVEASFELNDASKTIKVLSESDFQVNQ
LLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQGIESATQKKIVKMIKDSKLK
VQAQIQGDEIRVTGKSRDDLQAVMAMVRGGDLGQPFQFKNFRD