Protein Info for OHPLBJKB_02490 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Protein-lysine deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 TIGR02364: dihydroxyacetone kinase, phosphotransfer subunit" amino acids 2 to 127 (126 residues), 138.8 bits, see alignment E=1.1e-44 PF03610: EIIA-man" amino acids 4 to 120 (117 residues), 94.2 bits, see alignment E=1.2e-30 TIGR01003: phosphocarrier, HPr family" amino acids 159 to 234 (76 residues), 52.5 bits, see alignment E=3.6e-18 PF00381: PTS-HPr" amino acids 160 to 236 (77 residues), 64.1 bits, see alignment E=2e-21 PF05524: PEP-utilisers_N" amino acids 258 to 368 (111 residues), 75.2 bits, see alignment E=1.1e-24 PF00391: PEP-utilizers" amino acids 394 to 465 (72 residues), 48.2 bits, see alignment E=1.3e-16

Best Hits

Swiss-Prot: 100% identical to DHAM_ECOLI: PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM (dhaM) from Escherichia coli (strain K12)

KEGG orthology group: K05881, PTS hybrid protein (inferred from 100% identity to eco:b1198)

MetaCyc: 100% identical to dihydroxyacetone kinase subunit M (Escherichia coli K-12 substr. MG1655)
Phosphoenolpyruvate--glycerone phosphotransferase. [EC: 2.7.1.121]

Predicted SEED Role

"Phosphoenolpyruvate-dihydroxyacetone phosphotransferase (EC 2.7.1.121), subunit DhaM; DHA-specific IIA component / DHA-specific phosphocarrier protein HPr / DHA-specific EI component" in subsystem Dihydroxyacetone kinases (EC 2.7.1.121)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.121

Use Curated BLAST to search for 2.7.1.121

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (472 amino acids)

>OHPLBJKB_02490 Protein-lysine deacetylase (Escherichia coli HS(pFamp)R (ATCC 700891))
MVNLVIVSHSSRLGEGVGELARQMLMSDSCKIAIAAGIDDPQNPIGTDAVKVMEAIESVA
DADHVLVMMDMGSALLSAETALELLAPEIAAKVRLCAAPLVEGTLAATVSAASGADIDKV
IFDAMHALEAKREQLGLPSSDTEISDTCPAYDEEARSLAVVIKNRNGLHVRPASRLVYTL
STFNADMLLEKNGKCVTPESINQIALLQVRYNDTLRLIAKGPEAEEALIAFRQLAEDNFG
ETEEVAPPTLRPVPPVSGKAFYYQPVLCTVQAKSTLTVEEEQERLRQAIDFTLLDLMTLT
AKAEASGLDDIAAIFSGHHTLLDDPELLAAASELLQHEHCTAEYAWQQVLKELSQQYQQL
DDEYLQARYIDVDDLLHRTLVHLTQTKEELPQFNSPTILLAENIYPSTVLQLDPAVVKGI
CLSAGSPVSHSALIARELGIGWICQQGEKLYAIQPEETLTLDVKTQRFNRQG