Protein Info for OHPLBJKB_02475 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Release factor glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR00536: methyltransferase, HemK family" amino acids 1 to 277 (277 residues), 356.5 bits, see alignment E=9.1e-111 PF17827: PrmC_N" amino acids 6 to 73 (68 residues), 77.8 bits, see alignment E=4.2e-25 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 23 to 271 (249 residues), 299 bits, see alignment E=2.9e-93 PF01135: PCMT" amino acids 88 to 167 (80 residues), 25.2 bits, see alignment E=7.2e-09 PF06325: PrmA" amino acids 101 to 183 (83 residues), 25.8 bits, see alignment E=4.1e-09 PF05175: MTS" amino acids 105 to 191 (87 residues), 62.4 bits, see alignment E=2.2e-20 PF10294: Methyltransf_16" amino acids 108 to 173 (66 residues), 22.2 bits, see alignment E=5.6e-08 PF03602: Cons_hypoth95" amino acids 110 to 190 (81 residues), 26.1 bits, see alignment E=3.4e-09 PF13847: Methyltransf_31" amino acids 111 to 240 (130 residues), 59.7 bits, see alignment E=1.6e-19 PF02390: Methyltransf_4" amino acids 113 to 172 (60 residues), 34.3 bits, see alignment E=8.9e-12 PF13649: Methyltransf_25" amino acids 113 to 183 (71 residues), 38.2 bits, see alignment E=1.1e-12 PF08241: Methyltransf_11" amino acids 114 to 182 (69 residues), 22.8 bits, see alignment E=6.7e-08

Best Hits

Swiss-Prot: 100% identical to PRMC_ECOLI: Release factor glutamine methyltransferase (prmC) from Escherichia coli (strain K12)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to eco:b1212)

MetaCyc: 100% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.297

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>OHPLBJKB_02475 Release factor glutamine methyltransferase (Escherichia coli HS(pFamp)R (ATCC 700891))
MEYQHWLREAISQLQASESPRRDAEILLEHVTGRGRTFILAFGETQLTDEQCQQLDALLT
RRRDGEPIAHLTGVREFWSLPLFVSPATLIPRPDTECLVEQALARLPEQPCRILDLGTGT
GAIALALASERPDCEIIAVDRMPDAVSLAQRNAQHLAIKNIHILQSDWFSALAGQQFAMI
VSNPPYIDEQDPHLQQGDVRFEPLTALVAADSGMADIVHIIEQSRNALVSGGFLLLEHGW
QQGEAVRQAFILAGYHDVETCRDYGDNERVTLGRYYQ