Protein Info for OHPLBJKB_02430 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: putative acyl-CoA thioester hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03061: 4HBT
  • amino acids 26 to 98 (73 residues), 69.9 bits, E=9.7e-24

Best Hits

Swiss-Prot: 100% identical to YCIA_SHIFL: Acyl-CoA thioester hydrolase YciA (yciA) from Shigella flexneri

KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 100% identity to eco:b1253)

MetaCyc: 100% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]

Predicted SEED Role

"Acyl-CoA thioesterase YciA, involved in membrane biogenesis"

MetaCyc Pathways

• acyl-CoA hydrolysis (1/1 steps found)
• firefly bioluminescence (2/14 steps found)
• jasmonic acid biosynthesis (4/19 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Protein Sequence (132 amino acids)

>OHPLBJKB_02430 putative acyl-CoA thioester hydrolase (Escherichia coli HS(pFamp)R (ATCC 700891))
MSTTHNVPQGDLVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVE
GMTFLRPVAVGDVVCCYARCVQKGTTSVSINIEVWVKKVASEPIGQRYKATEALFKYVAV
DPEGKPRALPVE