Protein Info for OHPLBJKB_02364 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: sn-glycerol-3-phosphate import ATP-binding protein UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 PF00005: ABC_tran" amino acids 20 to 162 (143 residues), 107.6 bits, see alignment E=2.1e-34 PF17912: OB_MalK" amino acids 236 to 288 (53 residues), 52.1 bits, see alignment 2.5e-17 PF08402: TOBE_2" amino acids 282 to 351 (70 residues), 38.9 bits, see alignment E=2e-13 PF03459: TOBE" amino acids 295 to 350 (56 residues), 24.5 bits, see alignment E=6.7e-09

Best Hits

Swiss-Prot: 99% identical to YCJV_ECOLI: Putative uncharacterized ABC transporter ATP-binding protein YcjV (ycjV) from Escherichia coli (strain K12)

KEGG orthology group: K10112, maltose/maltodextrin transport system ATP-binding protein (inferred from 100% identity to ecx:EcHS_A1433)

Predicted SEED Role

"Multiple sugar ABC transporter, ATP-binding protein" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization or Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>OHPLBJKB_02364 sn-glycerol-3-phosphate import ATP-binding protein UgpC (Escherichia coli HS(pFamp)R (ATCC 700891))
MAQFSLQHIQKIYDNQVHVVKDFNLEIADKEFIVFVGPSGCGKSTTLRMIAGLEEISGGD
LLIDGKRMNDVPAKARNIAMVFQNYALYPHMTVYDNMAFDLKMQKIAKEVIDERVNWAAQ
ILGLREYLKRKPGALSGGQRQRVALGRAIVREAGVFLMDEPLSNLDAKLRVQMRAEISKL
HQKLNTTMIYVTHDQTEAMTMATRIVIMKDGIVQQVGAPKTVYNQPANMFVSGFIGSPAM
NFIRGTIDGDKFVTETLKLTIPEEKLAVLKTQESLHKPIVMGIRPEDIHPDAQEENNISA
KISVAELTGAEFMLYTTVGGHELVVRAGALNDYHAGENITIHFDMTKCHFFDAETEIAIR