Protein Info for OHPLBJKB_01570 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 38 to 55 (18 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details PF03788: LrgA" amino acids 23 to 113 (91 residues), 100.3 bits, see alignment E=2.5e-33

Best Hits

Swiss-Prot: 100% identical to YOHJ_ECO55: UPF0299 membrane protein YohJ (yohJ) from Escherichia coli (strain 55989 / EAEC)

KEGG orthology group: K06518, holin-like protein (inferred from 100% identity to eco:b2141)

Predicted SEED Role

"Antiholin-like protein LrgA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>OHPLBJKB_01570 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MSKTLNIIWQYLRAFVLIYACLYAGIFIASLLPVTIPGSIIGMLILFVLLALQILPAKWV
NPGCYVLIRYMALLFVPIGVGVMQYFDLLRAQFGPVVVSCAVSTLVVFLVVSWSSQLVHG
ERKVVGQKGSEE