Protein Info for OHPLBJKB_01516 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Thiol:disulfide interchange protein DsbE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR00385: periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily" amino acids 6 to 178 (173 residues), 283.3 bits, see alignment E=2.9e-89 PF00578: AhpC-TSA" amino acids 41 to 157 (117 residues), 58.4 bits, see alignment E=1.1e-19 PF08534: Redoxin" amino acids 42 to 165 (124 residues), 88.3 bits, see alignment E=6.9e-29 PF13098: Thioredoxin_2" amino acids 66 to 168 (103 residues), 29.3 bits, see alignment E=1.4e-10

Best Hits

Swiss-Prot: 100% identical to DSBE_SHIFL: Thiol:disulfide interchange protein DsbE (dsbE) from Shigella flexneri

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 100% identity to eco:b2195)

MetaCyc: 100% identical to thiol:disulfide oxidoreductase CcmG (Escherichia coli K-12 substr. MG1655)
1.8.4.-; RXN-21424; RXN-21425

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (185 amino acids)

>OHPLBJKB_01516 Thiol:disulfide interchange protein DsbE (Escherichia coli HS(pFamp)R (ATCC 700891))
MKRKVLLIPLIIFLAIAAALLWQLARNAEGDDPTNLESALIGKPVPKFRLESLDNPGQFY
QADVLTQGKPVLLNVWATWCPTCRAEHQYLNQLSAQGIRVVGMNYKDDRQKAISWLKELG
NPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGIIRYRHAGDLNPRVWEEEIKPLWEKYS
KEAAQ