Protein Info for OHPLBJKB_01256 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: tRNA(Met) cytidine acetyltransferase TmcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08351: TmcA_N
  • amino acids 60 to 145 (86 residues), 27.9 bits, E=6.2e-10
• PF13604: AAA_30
  • amino acids 177 to 281 (105 residues), 29.2 bits, E=2.2e-10
• PF05127: Helicase_RecD
  • amino acids 197 to 337 (141 residues), 147.5 bits, E=1.2e-46
• PF13718: GNAT_acetyltr_2
  • amino acids 369 to 483 (115 residues), 42.7 bits, E=1.4e-14
  • amino acids 483 to 532 (50 residues), 30.7 bits, 6.5e-11
• PF17176: tRNA_bind_3
  • amino acids 537 to 654 (118 residues), 152.7 bits, E=1.6e-48

Best Hits

Swiss-Prot: 98% identical to TMCA_SHIF8: tRNA(Met) cytidine acetyltransferase TmcA (tmcA) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K06957, tRNA(Met) cytidine acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to ecx:EcHS_A2605)

MetaCyc: 97% identical to tRNAMet cytidine acetyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-5418 [EC: 2.3.1.193]

Predicted SEED Role

"Predicted P-loop ATPase fused to an acetyltransferase COG1444"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.193

Protein Sequence (671 amino acids)

>OHPLBJKB_01256 tRNA(Met) cytidine acetyltransferase TmcA (Escherichia coli HS(pFamp)R (ATCC 700891))
MAELTALHTLTAQMKREGIRRLLVLSGEEGWCFDHALKLRDALPGDWLWISPQPDAENHC
SPSALQTLLGREFRHAVFDARHGFDAAAFAALSGTLKAGSWLVLLLPVWEEWENQPDADS
LRWSDCPDPIATPHFVQHLKRVLTADNDAILWRQNQPFSLAHFTPRTDWHPATGAPQPEQ
QQLLQQLLTMPPGVAAVTAARGRGKSALAGQLISRIAGSAIVTAPAKAATDVLAQFAGEK
FRFIAPDALLASDEQADWLVVDEAAAIPAPLLHQLVSRFPRTLLTTTVQGYEGTGRGFLL
KFCARFPHLHRFELQQPIRWAQGCPLEKMVSEALVFDDENFTHTPQGNIVISAFEQTLWR
SEPETPLKVYQLLSGAHYRTSPLDLRRMMDAPGQYFLQAAGENEIAGALWLVDEGGLSQQ
LSQAVWAGFRRPRGNLVAQSLAAHGSNPLAATLRGRRVSRIAVHPARQREGTGQQLIAGA
LQYTRDLDYLSVSFGYTGELWRFWHRCGFVLVRMGNHREASSGCYTAMALLPMSDAGKQL
AEREHYRLRRDAQALAQWNGETLPVDPLNDAILSDDDWLELAGFAFAHRPLLTSLGCLLR
LLQTSELALPALRGRLQKNASDAQLCTTLKLSGRKMLLVRQREEAAQALFALNNVRTERL
RDRITQWQFFH