Protein Info for OHPLBJKB_01119 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Alpha-ketoglutarate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 21 to 49 (29 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details amino acids 337 to 360 (24 residues), see Phobius details amino acids 371 to 393 (23 residues), see Phobius details amino acids 405 to 423 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 24 to 221 (198 residues), 94.8 bits, see alignment E=8.9e-31 amino acids 222 to 424 (203 residues), 47.8 bits, see alignment E=1.5e-16 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 30 to 417 (388 residues), 486.3 bits, see alignment E=3.7e-150 PF07690: MFS_1" amino acids 64 to 383 (320 residues), 96.4 bits, see alignment E=2.5e-31 PF13347: MFS_2" amino acids 164 to 367 (204 residues), 32.4 bits, see alignment E=5.7e-12

Best Hits

Swiss-Prot: 100% identical to KGTP_ECOLI: Alpha-ketoglutarate permease (kgtP) from Escherichia coli (strain K12)

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 100% identity to eco:b2587)

MetaCyc: 100% identical to alpha-ketoglutarate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-23

Predicted SEED Role

"Alpha-ketoglutarate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>OHPLBJKB_01119 Alpha-ketoglutarate permease (Escherichia coli HS(pFamp)R (ATCC 700891))
MAESTVTADSKLTSSDTRRRIWAIVGASSGNLVEWFDFYVYSFCSLYFAHIFFPSGNTTT
QLLQTAGVFAAGFLMRPIGGWLFGRIADKHGRKKSMLLSVCMMCFGSLVIACLPGYETIG
TWAPALLLLARLFQGLSVGGEYGTSATYMSEVAVEGRKGFYASFQYVTLIGGQLLALLVV
VVLQHTMEDAALREWGWRIPFALGAVLAVVALWLRRQLDETSQQETRALKEAGSLKGLWR
NRRAFIMVLGFTAAGSLCFYTFTTYMQKYLVNTAGMHANVASGIMTAALFVFMLIQPLIG
ALSDKIGRRTSMLCFGSLAAIFTVPILSALQNVSSPYAAFGLVMCALLIVSFYTSISGIL
KAEMFPAQVRALGVGLSYAVANAIFGGSAEYVALSLKSIGMETAFFWYVTLMAVVAFLVS
LMLHRKGKGMRL