Protein Info for OHPLBJKB_00721 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: 8-amino-7-oxononanoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 PF00155: Aminotran_1_2" amino acids 44 to 385 (342 residues), 176 bits, see alignment E=1.3e-55 PF00266: Aminotran_5" amino acids 92 to 216 (125 residues), 22.5 bits, see alignment E=5.3e-09

Best Hits

Swiss-Prot: 40% identical to BIOF_DESDA: Putative 8-amino-7-oxononanoate synthase (bioF) from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 98% identity to eci:UTI89_C3400)

MetaCyc: 34% identical to 2-amino-3-ketobutyrate CoA ligase (Escherichia coli K-12 substr. MG1655)
Glycine C-acetyltransferase. [EC: 2.3.1.29]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.29, 2.3.1.47

Use Curated BLAST to search for 2.3.1.29 or 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>OHPLBJKB_00721 8-amino-7-oxononanoate synthase (Escherichia coli HS(pFamp)R (ATCC 700891))
MGLYDKYARLAGERLQFSDNGLTPFGTCIDEVYSATEGRIGNKKVILAGTNNYLGLTFNH
DAIAEGQAALAAQGTGTTGSRMANGSYAPHLALEKEIAEFFNRPTAIVFSTGYTANLGVI
SALADHNAVVLLDADSHASIYDACSLGGAEIIRFRHNDAKDLERRMVRLGERAKEAIIIV
EGIYSMLGDVAPLAEIVDIKRRLGGYLIVDEAHSFGVLGATGRGLAEAVGVEDDVDIIVG
TFSKSLASIGGFAVGSEAMEVLRYGSRPYIFTASPSPSCIATVRSSLRTIATQPELRQKL
MDNANHLYDGLQKLGYELSSHISPVVPVIIGSKEEGLRIWRELISLGVYVNLILPPAAPA
GITLLRCSVNAAHSREQIDAIIQAFATLKQ