Protein Info for OHPLBJKB_00659 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Outer membrane usher protein PapC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 836 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details PF13954: PapC_N" amino acids 38 to 180 (143 residues), 108 bits, see alignment E=6.2e-35 PF00577: Usher" amino acids 198 to 750 (553 residues), 631.2 bits, see alignment E=2.9e-193 PF13953: PapC_C" amino acids 762 to 814 (53 residues), 37.7 bits, see alignment 2.2e-13

Best Hits

Swiss-Prot: 96% identical to YQIG_ECOLI: Putative outer membrane usher protein YqiG (yqiG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecx:EcHS_A3222)

Predicted SEED Role

"Uncharacterized outer membrane usher protein yqiG precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (836 amino acids)

>OHPLBJKB_00659 Outer membrane usher protein PapC (Escherichia coli HS(pFamp)R (ATCC 700891))
MDQMYKKLKLTTISELIKNIYCSLSVIIIGCASAYAVEFNKDLIEAEDRENVNLSQFETD
GQLPVGKYSLSTLINNKRTPIHLDLQWVLIDNQTAVCLTPEQLTLLGFTDEIIEEAQQNL
IDGCYPIEKEKQITTYLDKGKMQLSISAPQAWLKYKDANWTPPELWDHGIAGAFLDYNLY
ASHYAPHQGDNSQNISSYGQAGVNLGAWRLRTDYQYDQSFNNGKSQANNLDFPRIYLFRP
IPEINAKLTIGQYDTESSIFDSFHFSGISLKSDENMLPPDLRGYAPQITGVAQTNAKVTV
SQNNRIIYQENVPPGPFSITNLFNTLQGQLDVKVEEEDGRVTQWQVASNSIPYLTRKGQI
RYTTAMGKPTSVGGDSLQQPFFWTGEFSWGWLNNVSLYGGSVLTNRDYQSLATGVGFNLN
SLGSLSFDVTRSDAQLHNQNKETGYSYRANYSKRFESTGSQLTFAGYRFSDKNFVSMNEY
INDTNHYTNYQNEKESYIVTFNQYLESLRLNTYVSLARNTYWDASSNVNYSLSLSRDFDI
GPLKNVSTSLTFSRINWEDDNQDQLYLNISIPWGTSRTLSYGMQRNQDNNISHTASWYDS
SDRNNSWSVSASGDNDEFKDMEASLRASYQHNTENGRLYLSGTSQRDSYYSLNASWNGSF
TATRHGAAFHDYSGSADSRFMIDADGAEDIQLNNKRAVTNRYGIGVIPSVSSYITTSLSV
DTRNLPENVDIENSVITTTLTEGAIGYAKLDTRKGYQIMGIIRLADGSHPPLGISVKDET
SHKELGLVADGGFVYLNGIQDDSKITLHWGDKSCFIQPPPNSSNLTTGTVILPCIS