Protein Info for OHPLBJKB_00586 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: PFL-like enzyme TdcE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01255: formate acetyltransferase
  • amino acids 15 to 764 (750 residues), 1294.7 bits, E=0
• PF02901: PFL-like
  • amino acids 26 to 618 (593 residues), 687 bits, E=3.2e-210
• PF01228: Gly_radical
  • amino acids 634 to 745 (112 residues), 123.2 bits, E=6.8e-40

Best Hits

Swiss-Prot: 100% identical to TDCE_ECOLI: PFL-like enzyme TdcE (tdcE) from Escherichia coli (strain K12)

KEGG orthology group: K00656, formate C-acetyltransferase [EC: 2.3.1.54] (inferred from 100% identity to eck:EC55989_3531)

MetaCyc: 79% identical to pyruvate formate-lyase (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"2-ketobutyrate formate-lyase (EC 2.3.1.-) / Pyruvate formate-lyase (EC 2.3.1.54)" in subsystem Threonine anaerobic catabolism gene cluster or Butanol Biosynthesis or Fermentations: Mixed acid (EC 2.3.1.-, EC 2.3.1.54)

MetaCyc Pathways

• superpathway of N-acetylneuraminate degradation (21/22 steps found)
• mixed acid fermentation (16/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (18/19 steps found)
• superpathway of L-threonine metabolism (16/18 steps found)
• L-threonine degradation I (6/6 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
• pyruvate fermentation to acetate IV (3/3 steps found)
• pyruvate fermentation to ethanol I (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Propanoate metabolism
• Pyruvate metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.54

Use Curated BLAST to search for 2.3.1.- or 2.3.1.54

Protein Sequence (764 amino acids)

>OHPLBJKB_00586 PFL-like enzyme TdcE (Escherichia coli HS(pFamp)R (ATCC 700891))
MKVDIDTSDKLYADAWLGFKGTDWKNEINVRDFIQHNYTPYEGDESFLAEATPATTELWE
KVMEGIRIENATHAPVDFDTNIATTITAHDAGYINQPLEKIVGLQTDAPLKRALHPFGGI
NMIKSSFHAYGREMDSEFEYLFTDLRKTHNQGVFDVYSPDMLRCRKSGVLTGLPDGYGRG
RIIGDYRRVALYGISYLVRERELQFADLQSRLEKGEDLEATIRLREELAEHRHALLQIQE
MAAKYGFDISRPAQNAQEAVQWLYFAYLAAVKSQNGGAMSLGRTASFLDIYIERDFKAGV
LNEQQAQELIDHFIMKIRMVRFLRTPEFDSLFSGDPIWATEVIGGMGLDGRTLVTKNSFR
YLHTLHTMGPAPEPNLTILWSEELPIAFKKYAAQVSIVTSSLQYENDDLMRTDFNSDDYA
IACCVSPMVIGKQMQFFGARANLAKTLLYAINGGVDEKLKIQVGPKTAPLMDDVLDYDKV
MDSLDHFMDWLAVQYISALNIIHYMHDKYSYEASLMALHDRDVYRTMACGIAGLSVATDS
LSAIKYARVKPIRDENGLAVDFEIDGEYPQYGNNDERVDSIACDLVERFMKKIKALPTYR
NAVPTQSILTITSNVVYGQKTGNTPDGRRAGTPFAPGANPMHGRDRKGAVASLTSVAKLP
FTYAKDGISYTFSIVPAALGKEDPVRKTNLVGLLDGYFHHEADVEGGQHLNVNVMNREML
LDAIEHPEKYPNLTIRVSGYAVRFNALTREQQQDVISRTFTQAL