Protein Info for OHPLBJKB_00545 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 PF01541: GIY-YIG" amino acids 7 to 79 (73 residues), 58.1 bits, see alignment E=4.5e-20

Best Hits

Swiss-Prot: 100% identical to YHBQ_ECO81: UPF0213 protein YhbQ (yhbQ) from Escherichia coli O81 (strain ED1a)

KEGG orthology group: K07461, putative endonuclease (inferred from 100% identity to ebd:ECBD_0585)

MetaCyc: 99% identical to DNA damage response nuclease YhbQ (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"FIG137864: putative endonuclease containing a URI domain" in subsystem CBSS-214092.1.peg.3450

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.1

Use Curated BLAST to search for 3.1.11.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (103 amino acids)

>OHPLBJKB_00545 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MQTMTPWFLYLIRTADNKLYTGITTDVERRYQQHQSGKGAKALRGKGELTLAFSAPVGDR
SLALRAEYRVKQLTKRQKERLVAEGAGFAELLSSLQTPEIKSD