Protein Info for OH686_23790 in Pseudomonas sp. S08-1

Annotation: Methyl-accepting chemotaxis sensor/transducer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 630 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 279 to 302 (24 residues), see Phobius details PF02743: dCache_1" amino acids 37 to 261 (225 residues), 105.1 bits, see alignment E=6.2e-34 PF00672: HAMP" amino acids 297 to 349 (53 residues), 51.4 bits, see alignment 1.7e-17 PF00015: MCPsignal" amino acids 413 to 595 (183 residues), 145.9 bits, see alignment E=1.7e-46

Best Hits

Swiss-Prot: 66% identical to PCTC_PSEAE: Methyl-accepting chemotaxis protein PctC (pctC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 72% identity to pba:PSEBR_a371)

Predicted SEED Role

"Chemotactic transducer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (630 amino acids)

>OH686_23790 Methyl-accepting chemotaxis sensor/transducer protein (Pseudomonas sp. S08-1)
MPSNLKFSQKILLAASLVTIVAFTLFVLFNDYRQRQTLNADVHASLQEVGSLATRNIKTW
LDGRIQLVESLAQQLSANGEQGQPLEAALNLPVYGQRFQLTYFGGADGAMTSVPVGNRPA
DYDPRARGWYKAASAAQGSALTEPYIAASSQKLVITIATPVRRDGQMVGVAGADMDLASI
AQLLESLKFQGHGHAFLVSAQGKVLLHPDSNYTLKDIQELYPQDTPRVQAGVSEVEVDGK
TQFIAFTPLEGLPSANWYVALVLDQDAAFAALGEFRTSAVVATIVAVIATVFLLGMLIRV
LMQPLLLMGKAMRDIAQGDGDLTKRLSVQSQDEFGELATSFNQFVERIHGSIREVSSATG
QLNEVAKLVVNASNSSMANSDEQASRTNSVAAAINELGAAAQEIARNAADASNQASDARH
LAEDGSQVLQKTIVAMNELSEKISASSANIEVLNSKTVDIGQILEVIKSISAQTNLLALN
AAIEAARAGEAGRGFAVVADEVRSLAHRTQESAQEIHKMIEELQVGARDSVTTMTESQHY
SAQSVEIANQAGERLGSVTQRIGEIDGMNQSVATATEEQTAVVEALNMDINEINTLNQEG
VENLQATLRACGDLERQAARLQQLVGSFRI