Protein Info for OH686_22590 in Pseudomonas sp. S08-1

Annotation: Organic hydroperoxide resistance transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12802: MarR_2
  • amino acids 40 to 103 (64 residues), 39.7 bits, E=6.4e-14
• PF01047: MarR
  • amino acids 41 to 103 (63 residues), 51.5 bits, E=1.1e-17
• PF13463: HTH_27
  • amino acids 61 to 112 (52 residues), 24.2 bits, E=4.9e-09

Best Hits

Swiss-Prot: 49% identical to OHRR_BACSU: Organic hydroperoxide resistance transcriptional regulator (ohrR) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 75% identity to pmk:MDS_2987)

Predicted SEED Role

"Organic hydroperoxide resistance transcriptional regulator" in subsystem Oxidative stress

Protein Sequence (155 amino acids)

>OH686_22590 Organic hydroperoxide resistance transcriptional regulator (Pseudomonas sp. S08-1)
MTASHDLEAQLLLDNQLCFKLYAASRAVIRAYKPMLDELGLTYPQYLAMLVLWEWQAAPP
EQATVKALGERLMLDSGTLTPLLKRLEQLGLVRRSRSSADERELRLALSEAGLALRERVL
PLKSRLLCEHGVDLGELEGMRQSLGQLLALVTARS