Protein Info for OH686_17875 in Pseudomonas sp. S08-1

Annotation: 23S rRNA (adenine(1618)-N(6))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF05971: Methyltransf_10" amino acids 25 to 322 (298 residues), 451.4 bits, see alignment E=1.6e-139 PF05175: MTS" amino acids 127 to 217 (91 residues), 23.9 bits, see alignment E=2.8e-09

Best Hits

Swiss-Prot: 72% identical to RLMF_PSEMY: Ribosomal RNA large subunit methyltransferase F (rlmF) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K06970, ribosomal RNA large subunit methyltransferase F [EC: 2.1.1.181] (inferred from 71% identity to pmk:MDS_3801)

MetaCyc: 54% identical to 23S rRNA m6A1618 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11596 [EC: 2.1.1.181]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase F (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.51

Use Curated BLAST to search for 2.1.1.181 or 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>OH686_17875 23S rRNA (adenine(1618)-N(6))-methyltransferase  (Pseudomonas sp. S08-1)
MRAPPAEPPVMRQKAQPPRQPKAVVKGQLHPRNRHQGRYDFPKLIEASPELGRFVILNPY
GKQSIDFADPEAVKVFNRALMRQLYGIAHWDIPPGYLCPPIPGRADYLHGLADLLAESND
GAIPRGKAVRALDIGTGANCIYPLLGHSDYGWRFLGSDIDPVALAAARVIVQANGLADAI
ELRQQSEPQHIFQGLLASDERFTLTLCNPPFHASAAEAVSGSTRKWKNLGKLDPKRKLPV
LNFGGQSNELWCEGGEAAFLRRMAGESAAVAGQVLWFSSLVSKASNLPGLEAALKKAGAL
EVRQLNMAQGNKQSRFVAWTFHEVAARRAWLNGSIAAGAN