Protein Info for OH686_17545 in Pseudomonas sp. S08-1

Annotation: outer membrane assembly lipoprotein YfgL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 9 to 380 (372 residues), 457.3 bits, see alignment E=1.5e-141 PF13360: PQQ_2" amino acids 46 to 97 (52 residues), 22.7 bits, see alignment 1.1e-08 amino acids 77 to 308 (232 residues), 189.3 bits, see alignment E=1.3e-59 PF13570: PQQ_3" amino acids 48 to 86 (39 residues), 20.3 bits, see alignment 9.1e-08 amino acids 129 to 168 (40 residues), 36.8 bits, see alignment 5.6e-13 amino acids 239 to 264 (26 residues), 19.4 bits, see alignment (E = 1.7e-07) PF01011: PQQ" amino acids 72 to 103 (32 residues), 22 bits, see alignment (E = 1.6e-08) amino acids 110 to 146 (37 residues), 29.2 bits, see alignment 8.1e-11 amino acids 150 to 182 (33 residues), 27.4 bits, see alignment 3.1e-10

Best Hits

Swiss-Prot: 68% identical to BAMB_PSEAE: Outer membrane protein assembly factor BamB (bamB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 76% identity to pba:PSEBR_a939)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>OH686_17545 outer membrane assembly lipoprotein YfgL (Pseudomonas sp. S08-1)
MPDVMRWKNAAVLALAVVAVGCSSNSKKELPPAELPDIQEEVRLDAQWSRSIGDGQGELY
NQLTPAADGERLYAASADGEVVALDRLTGDKFWEVELDLPISGGVGAGYGLVLIGTLKGE
VVALDSSNGEEKWRARVTSEVLSAPATNGDVVVVQTQDDRLIAFDASTGEQRWIYENSPA
VLTLRGTSSPVMTNRLVMAGLSTGKVLALDANRGIPVWEQRVAVPQGRSELERVVDIDGN
LLLSGGTLYVVTYQGNVAAIDVESGRPLWNREASSYVGLAQGFGSVYVSLASGAVEGVDE
GSNSALWNNDALQRRQLSSPEVFSSYVAVGDFEGYLHLLSQVDGHFVGRKKIDGDGLRAR
PLVVGDWIYAYGNSGKLVGLTIR