Protein Info for OH686_16945 in Pseudomonas sp. S08-1

Annotation: Glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13409: GST_N_2
  • amino acids 11 to 73 (63 residues), 36.4 bits, E=1.6e-12
• PF13417: GST_N_3
  • amino acids 17 to 77 (61 residues), 30.9 bits, E=7e-11
• PF14497: GST_C_3
  • amino acids 123 to 198 (76 residues), 22.2 bits, E=3.3e-08
• PF13410: GST_C_2
  • amino acids 127 to 185 (59 residues), 28.9 bits, E=2.6e-10
• PF00043: GST_C
  • amino acids 129 to 194 (66 residues), 36.1 bits, E=1.5e-12

Best Hits

Swiss-Prot: 37% identical to GST_XANCP: Glutathione S-transferase GST-4.5 (gst) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 72% identity to avn:Avin_22380)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Protein Sequence (208 amino acids)

>OH686_16945 Glutathione S-transferase  (Pseudomonas sp. S08-1)
MPTLYISPGACSLASHIVVHELALPIQVEQVALRTPDSPIHAINPLGRVPALQLDDGTLL
TENSALLPYLADQVPDTPLFAPVGSAERAQIQGWLGYLAAEVHTASFRPLNRPERYSADE
AVHPGIRAQALQQLYKAFEHIDRHLQGRQWLVGERYTLADAYLGLFANWLLRLGAPFDQL
THVARLREQWAARPAVQQALRTEGLLKD