Protein Info for OH686_15955 in Pseudomonas sp. S08-1

Annotation: UPF0313 [4Fe-4S] protein YgiQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 770 PF08497: Radical_SAM_N" amino acids 23 to 378 (356 residues), 460.2 bits, see alignment E=4.6e-142 TIGR03904: uncharacterized radical SAM protein YgiQ" amino acids 23 to 643 (621 residues), 874.3 bits, see alignment E=1.7e-267 PF04055: Radical_SAM" amino acids 379 to 584 (206 residues), 51 bits, see alignment E=3e-17 PF11842: DUF3362" amino acids 593 to 753 (161 residues), 172.4 bits, see alignment E=1.2e-54

Best Hits

Swiss-Prot: 90% identical to Y4928_PSEAE: UPF0313 protein PA4928 (PA4928) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 92% identity to pmy:Pmen_0652)

Predicted SEED Role

"Fe-S OXIDOREDUCTASE (1.8.-.-)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (770 amino acids)

>OH686_15955 UPF0313 [4Fe-4S] protein YgiQ (Pseudomonas sp. S08-1)
MQLAKPLFDYPKYWAECFGPAPFLPMSREEMDQLGWDSCDIIIVTGDAYVDHPSFGMAII
GRLLESQGFRVGIIAQPNWRSKDDFMKLGQPNLFFGVAAGNMDSMINRYTADKKIRSDDA
YTPGGLAGARPDRASLVYSQRCKEAYSQTPVILGGIEASLRRIAHYDYWQDKVRRSILMD
ATADILLYGNAERAVVEIAQRLAFGEAVENITDVRGTAFIRRDTPEGWYEVDSTRIDRPG
KIDKIINPYVNTQDTAACAIEQEKGPQEDPNEAKVVELLPSPKMTRAKTVIRLPSFEKVR
NDPVLYAHANRVLHLETNPGNARALVQKHGEVDVWFNPPPIPMTTEEMDYVFGMPYARVP
HPAYGKAKIPAYEMIRFSVNIMRGCFGGCTFCSITEHEGRIIQNRSHESIIREIEEMRDK
VPGFTGVVSDLGGPTANMYRIACKSPEIESACRKPSCVFPGICPNLNTDHSSLIELYRKA
RALPGVKKILIASGLRYDLAVESPEYVKELVTHHVGGYLKIAPEHTEEGPLNQMMKPGIG
SYDKFKRMFEKYSKEAGKEQYLIPYFIAAHPGTTDEDMMNLALWLKRNDFRADQVQAFYP
SPMASATAMYHSGKNPLRKVTYKSDGVTIVKSEQQRRLHKAFLRYHDPKGWPMLREALER
MGRSDLIGNGKHHLIPTYQPQTDEYQSARRKNSTPAGSKKVAGNGGDKGKTVGRILTQHT
GLPPRGSDGSKAWDKREQAKAAAEARRKAEKSGAGKPASKKPGKRPVAPR