Protein Info for OH686_14000 in Pseudomonas sp. S08-1

Annotation: Uncharacterized DUF4399 domain-containing protein PA0315

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF14347: DUF4399" amino acids 58 to 149 (92 residues), 123.9 bits, see alignment E=1.4e-40

Best Hits

KEGG orthology group: None (inferred from 63% identity to pae:PA0315)

Predicted SEED Role

"ATPases of the AAA+ class"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>OH686_14000 Uncharacterized DUF4399 domain-containing protein PA0315 (Pseudomonas sp. S08-1)
MRLSLRNSLRTWGLCALLCTALPALAENAVPQLPAPPGAEVYFIEPADGASVGQTFSVKF
GLKGMGVAPAGIDFPATGHHHLLVDVSTLPLLDVPLPATEHILHFGKGQTETELSLPPGT
HTLQLLVGDKNHVPMDPAVMSTKITITVQ