Protein Info for OH686_11310 in Pseudomonas sp. S08-1

Annotation: Spermidine/putrescine import ABC transporter permease protein PotC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 103 to 128 (26 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 261 (179 residues), 61.2 bits, see alignment E=5.8e-21

Best Hits

Swiss-Prot: 39% identical to POTC_SHIFL: Spermidine/putrescine transport system permease protein PotC (potC) from Shigella flexneri

KEGG orthology group: K02053, putative spermidine/putrescine transport system permease protein (inferred from 83% identity to pau:PA14_04230)

MetaCyc: 39% identical to spermidine preferential ABC transporter membrane subunit PotC (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component potC (TC_3.A.1.11.1)" in subsystem Polyamine Metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>OH686_11310 Spermidine/putrescine import ABC transporter permease protein PotC (Pseudomonas sp. S08-1)
MNLQGPLWRFTGVRPAAWAFFAFLYIPILVLVALSFNAGQSATLWQGFSLKWYGVVANDP
EILRAAKNSLIVAVCATLISTCLATLAALGMHGRRFRGQGALQGVLGLPLLVPDIVCAVA
ILMFFAFIGLKLSLLTILIAHVVFCTPFAYLPIRARLQGMDPRLLEAAADLYASPWRAFW
RISFPLLLPGILSGAMLAFIISMDDFVITYFVAGAGSTTLPVYIFSSIRMGISPKINAIS
SIMLVLSILFVTLSYYLGQRKR