Protein Info for OH686_09625 in Pseudomonas sp. S08-1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 10 to 29 (20 residues), see Phobius details amino acids 37 to 55 (19 residues), see Phobius details amino acids 67 to 84 (18 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 120 to 142 (23 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 216 to 232 (17 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 372 to 390 (19 residues), see Phobius details PF04932: Wzy_C" amino acids 200 to 325 (126 residues), 45.7 bits, see alignment E=3.1e-16

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>OH686_09625 hypothetical protein (Pseudomonas sp. S08-1)
MNVRDKLYPFFQYWLALGLFLQLAGLCFITDGSRYTAIGNLMLFLPALLAVVLLWPRLDS
WQRPLHAVLLALLGWVLIVALLNPGSDGSALRWLRVTLYTWLYLQAISLVMQDRRIWQRL
LVAVVLVAGLFAWGSLVQALYIEQRGLEYRAFRLFAWHRNGLADFGNPIVSALYFGVTAL
LAAHLSVKVSGILRWLCLFALIGMLTYQYFTYSRGVWISVLAGLATLSWFLLSWRLLGIA
IAVAVPLLVLMLFLLNSAGGLELSYRDVIFKRWLAQMDTFWLWGTGAGAEAKICVEAAGR
CFNQAHSLYLQFFFEYGLPGLLLLLTLVVLVLHKGWARRLQDDMVPLGLALMVFTLVASI
ANFYVIFLRPGVFWIVFWLPVGILLAISALPRRAVHLTSPGAPR