Protein Info for OH686_07680 in Pseudomonas sp. S08-1

Annotation: urea ABC transporter, ATP-binding protein UrtE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR03410: urea ABC transporter, ATP-binding protein UrtE" amino acids 2 to 232 (231 residues), 353.3 bits, see alignment E=2.6e-110 PF00005: ABC_tran" amino acids 17 to 161 (145 residues), 117.2 bits, see alignment E=8.9e-38

Best Hits

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 90% identity to pfv:Psefu_4079)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtE" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>OH686_07680 urea ABC transporter, ATP-binding protein UrtE (Pseudomonas sp. S08-1)
MLQVDKLHQYYGGSHILRGLSFEAKIGEVTCLLGRNGVGKTTLLKCLMGLIPAKEGSINW
EGQTINGHKPHQRVHAGIAYVPQGREIFPRLTVEENLLMGLSRFGASEAKTVPEFIYELF
PVLREMKQRRGGDLSGGQQQQLAIGRALASKPRLLILDEPTEGIQPSVIKEIGVVIRKLA
ERGDMAILLVEQFYDFAAELADQYLVMSRGEIVQQGRGETMEADGVRGLVAI