Protein Info for OH686_06515 in Pseudomonas sp. S08-1

Annotation: Cysteine desulfurase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 72% identical to CSD_PSEPK: Probable cysteine desulfurase (csdA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01766, cysteine sulfinate desulfinase [EC: 4.4.1.-] (inferred from 84% identity to pmk:MDS_3338)

Predicted SEED Role

"Cysteine desulfurase CsdA-CsdE (EC 2.8.1.7), main protein CsdA" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
superpathway of L-alanine biosynthesis (4/4 steps found)
thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
thiazole component of thiamine diphosphate biosynthesis I (5/6 steps found)
L-alanine biosynthesis III (1/1 steps found)
L-cysteine degradation IV (1/1 steps found)
molybdopterin biosynthesis (4/6 steps found)
cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
[2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)
tRNA-uridine 2-thiolation and selenation (bacteria) (4/11 steps found)
tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>OH686_06515 Cysteine desulfurase  (Pseudomonas sp. S08-1)
MSLTSPWRADFPGILALDAEGQTYLDSAATAQKPQVMLDSLFGYLASGAANVHRAQHLPG
ERATRAFEATRDKAAAWLNAASREEIVFTRGTSESLNLLAYGLEHLFQPGEQIVVSALEH
HANLLPWQQLALRRGLELVVLPLDASGSVDLQQAARLIGPRTRLLAVSQLSNVLGRWQPV
HELIALARTQGALTVIDGAQGAVHGRHDIQALGYDFYVCSSHKLYGPDGVGLLHGRREAL
EQLRHWQFGGEMVLQADYRESRFRPAPLGFEAGTPPISGVIALGATLDYLSGLDAATVAG
HEAALHAKLLAGLAVRDDVHLLGEPQLALASFTVDGVHSADLAHLLTDQGIAVRTGHHCA
MPLLKQLGLSGAIRVSLGLYNDGADLERFFAALDKALELLR