Protein Info for OH686_02040 in Pseudomonas sp. S08-1

Annotation: Efflux ABC transporter, permease/ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 68 to 91 (24 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details TIGR02204: ABC transporter, permease/ATP-binding protein" amino acids 8 to 583 (576 residues), 897.7 bits, see alignment E=1.8e-274 PF00664: ABC_membrane" amino acids 30 to 296 (267 residues), 159 bits, see alignment E=2.1e-50 PF00005: ABC_tran" amino acids 364 to 512 (149 residues), 110.5 bits, see alignment E=1.1e-35

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 80% identity to pap:PSPA7_4256)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>OH686_02040 Efflux ABC transporter, permease/ATP-binding protein (Pseudomonas sp. S08-1)
MSLFSDNRRQALGMAWRFVAPYRWRLVGALAALMFTAAITLSMGQGIRLLVDQGLATQSQ
SALNHSIALFFVLVLALAIGTFTRFYLVSWIGERFVADIRRKVFDHLIDLHPGFYESNRA
SEIQSRLTADTTLLQTVIGSSLSMALRNGIMLIGGVILLFVTNAKLSAIVVCSLPLVVAP
ILIFGRRVRALSRQTQDRVADVGSYIGETLGQIKTVQAYNHQAQDRQRFAGTVEAAFATA
GRRIRQRAWLITVVIVLVLGAVGAMLWVGGMDVIAGRISGGDLAAFVFYSLIVGMSFGAI
SEVIGELQSAAGAAERIAELLRTRNAITAPSEGLLQLPQRVSGEVELRGVRFFYPARPEQ
PAIDGIDLAVRAGETLALVGPSGAGKSTLFDLLLRFFDPQEGEVLVEGVPIQRLDPADLR
RCFALVSQNPALFFGSVEDNLRYGRPDASAAEVEAAARAAHAHEFIERLPQGYQTHLGEA
GLGLSGGQRQRLAIARALLTDAPILLLDEATSALDAESEHLIQQALPGLMRGRTTLVIAH
RLATVQNADRIAVVDRGRLQAIGTHAELVASNPLYARLAQLQFNTERR