Protein Info for OH686_00320 in Pseudomonas sp. S08-1

Annotation: Putative TEGT family carrier/transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 193 to 217 (25 residues), see Phobius details PF01027: Bax1-I" amino acids 20 to 215 (196 residues), 161.9 bits, see alignment E=9.4e-52

Best Hits

Swiss-Prot: 75% identical to Y2604_PSEAE: Uncharacterized protein PA2604 (PA2604) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06890, (no description) (inferred from 79% identity to pmk:MDS_2394)

Predicted SEED Role

"Putative TEGT family carrier/transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>OH686_00320 Putative TEGT family carrier/transport protein (Pseudomonas sp. S08-1)
MHEQDYALAHAQTDQLETSKVLRNTYGLLAMTLVFSALCAFFSAQLGLPHPGFLITLVGF
YGLFFLTAKLRNSGWGLVCAFALTGFMGYVLGPILNLYAGMANGSELIVSALGMTALVFF
GLSAYVLTTRKDMSFLGGFITAGCFVLLGAMVAGFFFQISGLQLAISAGFVLFASACILY
QTSEIIHGGERNYVMATISLYVSIYNLFVSLLQIFGIMGSDD