Protein Info for NOLOHH_24155 in Escherichia coli ECOR27

Name: envY
Annotation: DNA-binding transcriptional regulator EnvY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 121 to 142 (22 residues), see Phobius details amino acids 163 to 178 (16 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details PF12833: HTH_18" amino acids 169 to 245 (77 residues), 59 bits, see alignment E=4.7e-20 PF00165: HTH_AraC" amino acids 208 to 244 (37 residues), 40.9 bits, see alignment 1.7e-14

Best Hits

Swiss-Prot: 99% identical to ENVY_ECOLI: Porin thermoregulatory protein EnvY (envY) from Escherichia coli (strain K12)

KEGG orthology group: K11920, AraC family transcriptional regulator (inferred from 99% identity to eco:b0566)

Predicted SEED Role

"Transcriptional regulator of catabolic arginine decarboxylase (adiA)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>NOLOHH_24155 DNA-binding transcriptional regulator EnvY (Escherichia coli ECOR27)
MQLSSSEPCVVILTEKEVEVSVNNHATFTLPKNYLAAFACNNNVIELSTLNHVLIPHINR
NIINDYLLFLNKNLTCVKPWSRLATPVIACHSRTPEVFRLAANHSKQQPSKPCEAELTRA
LLFTVLSNFLEQSRFIALLMYILRSSVRDSVCRIIQSDIQHYWNLRIVASSLCLSPSLLK
KKLKNENTSYSQIVTECRMRYAVQMLLMDNKNITQVAQLCGYSSTSYFISVFKAFYGLTP
LNYLAKQRQKVMW