Protein Info for NOLOHH_17815 in Escherichia coli ECOR27

Name: fumD
Annotation: fumarate hydratase FumD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 69 PF10965: DUF2767" amino acids 1 to 67 (67 residues), 138.5 bits, see alignment E=2.9e-45

Best Hits

Swiss-Prot: 100% identical to FUMD_SHIFL: Fumarase D (fumD) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b1675)

MetaCyc: 100% identical to fumarase D (Escherichia coli K-12 substr. MG1655)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"FIG00637899: hypothetical protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (69 amino acids)

>NOLOHH_17815 fumarate hydratase FumD (Escherichia coli ECOR27)
MGNRTKEDELYREMCRVVGKVVLEMRDLGQEPKHIVIAGVLRTALANKRIQRSELEKQAM
ETVINALVK