Protein Info for NOLOHH_08410 in Escherichia coli ECOR27

Annotation: ABC-2 family transporter protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 22 to 40 (19 residues), see Phobius details amino acids 174 to 199 (26 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 256 to 280 (25 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 26 to 364 (339 residues), 119.8 bits, see alignment E=2.2e-38 PF12679: ABC2_membrane_2" amino acids 84 to 368 (285 residues), 56 bits, see alignment E=6e-19 PF01061: ABC2_membrane" amino acids 161 to 336 (176 residues), 91.2 bits, see alignment E=1e-29

Best Hits

Swiss-Prot: 100% identical to YHHJ_ECOLI: Inner membrane transport permease YhhJ (yhhJ) from Escherichia coli (strain K12)

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to eco:b3485)

Predicted SEED Role

"Putative transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (374 amino acids)

>NOLOHH_08410 ABC-2 family transporter protein (Escherichia coli ECOR27)
MRHLRNIFNLGIKELRSLLGDKAMLTLIVFSFTVSVYSSATVTPGSLNLAPIAIADMDQS
QLSNRIVNSFYRPWFLPPEMITADEMDAGLDAGRYTFAINIPPNFQRDVLAGRQPDIQVN
VDATRMSQAFTGNGYIQNIINGEVNSFVARYRDNSEPLVSLETRMRFNPNLDPAWFGGVM
AIINNITMLAIVLTGSALIREREHGTVEHLLVMPITPFEIMMAKVWSMGLVVLVVSGLSL
VLMVKGVLGVPIEGSIPLFMLGVALSLFATTSIGIFMGTIARSMPQLGLLVILVLLPLQM
LSGGSTPRESMPQMVQDIMLTMPTTHFVSLAQAILYRGAGFEIVWPQFLTLMAIGGAFFT
IALLRFRKTIGTMA