Protein Info for NOLOHH_07810 in Escherichia coli ECOR27

Name: ulaD
Annotation: 3-keto-L-gulonate-6-phosphate decarboxylase UlaD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF00215: OMPdecase" amino acids 4 to 204 (201 residues), 151.6 bits, see alignment E=1.6e-48

Best Hits

Swiss-Prot: 99% identical to SGBH_ECOLI: 3-keto-L-gulonate-6-phosphate decarboxylase SgbH (sgbH) from Escherichia coli (strain K12)

KEGG orthology group: K03081, 3-dehydro-L-gulonate-6-phosphate decarboxylase [EC: 4.1.1.85] (inferred from 99% identity to eco:b3581)

MetaCyc: 99% identical to 3-keto-L-gulonate-6-phosphate decarboxylase SgbH (Escherichia coli K-12 substr. MG1655)
3-dehydro-L-gulonate-6-phosphate decarboxylase. [EC: 4.1.1.85]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.85

Use Curated BLAST to search for 4.1.1.85

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>NOLOHH_07810 3-keto-L-gulonate-6-phosphate decarboxylase UlaD (Escherichia coli ECOR27)
MSRPLLQLALDHSSLEAAQRDVTQLKDSVDIVEAGTILCLNEGLGAVKALREQCPDKIIV
ADWKVADAGETLAQQAFGAGANWMTIICAAPLATVEKGHAMAQRCGGEIQIELFGNWTLD
DARDWHRIGVRQAIYHRGRDAQASGQQWGEADLARMKALSDIGLELSITGGITPADLPLF
KDIRVKAFIAGRALAGSANPAQVAGDFHAQIDAIWGGKRA