Protein Info for NOLOHH_07800 in Escherichia coli ECOR27

Name: araD
Annotation: L-ribulose-5-phosphate 4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00760: L-ribulose-5-phosphate 4-epimerase
  • amino acids 1 to 231 (231 residues), 445.3 bits, E=1.6e-138
• PF00596: Aldolase_II
  • amino acids 8 to 196 (189 residues), 173.7 bits, E=1.9e-55

Best Hits

Swiss-Prot: 100% identical to SGBE_ECOLI: L-ribulose-5-phosphate 4-epimerase SgbE (sgbE) from Escherichia coli (strain K12)

KEGG orthology group: K03080, L-ribulose-5-phosphate 4-epimerase [EC: 5.1.3.4] (inferred from 100% identity to eco:b3583)

MetaCyc: 100% identical to L-ribulose-5-phosphate 4-epimerase SgbE (Escherichia coli K-12 substr. MG1655)
L-ribulose-5-phosphate 4-epimerase. [EC: 5.1.3.4]

Predicted SEED Role

"L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4)" in subsystem L-Arabinose utilization or L-ascorbate utilization (and related gene clusters) (EC 5.1.3.4)

MetaCyc Pathways

• L-ascorbate degradation II (bacterial, aerobic) (7/7 steps found)
• L-ascorbate degradation I (bacterial, anaerobic) (5/5 steps found)
• L-arabinose degradation I (4/4 steps found)
• L-lyxose degradation (4/4 steps found)
• superpathway of pentose and pentitol degradation (16/42 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.4

Use Curated BLAST to search for 5.1.3.4

Protein Sequence (231 amino acids)

>NOLOHH_07800 L-ribulose-5-phosphate 4-epimerase (Escherichia coli ECOR27)
MLEQLKADVLAANLALPAHHLVTFTWGNVSAVDETRQWMVIKPSGVEYDVMTADDMVVVE
IASGKVVEGSKKPSSDTPTHLALYRRYAEIGGIVHTHSRHATIWSQAGLDLPAWGTTHAD
YFYGAIPCTRQMTAEEINGEYEYQTGEVIIETFEERGRSPAQIPAVLVHSHGPFAWGKNA
ADAVHNAVVLEECAYMGLFSRQLAPQLPAMQNELLDKHYLRKHGANAYYGQ