Protein Info for NOLOHH_01025 in Escherichia coli ECOR27

Name: ybaP
Annotation: Uncharacterized protein YbaP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF01963: TraB_PrgY_gumN" amino acids 30 to 264 (235 residues), 149.9 bits, see alignment E=6.6e-48

Best Hits

Swiss-Prot: 99% identical to YBAP_ECOLI: Uncharacterized protein YbaP (ybaP) from Escherichia coli (strain K12)

KEGG orthology group: K09973, hypothetical protein (inferred from 99% identity to eco:b0482)

Predicted SEED Role

"FIG00921183: possible ligase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>NOLOHH_01025 Uncharacterized protein YbaP (Escherichia coli ECOR27)
MDLLYRVKTLWAALRGNHYTWPAIDITLPGNRHFHLIGSIHMGSHDMAPLPTRLLKKLKN
ADALIVEADVSTSDTPFANLPTCEALEERINEEQLQNLQHISQEMGISPSLFSTQPLWQI
AMVLQATQAQKLGLRAEYGIDYQLLQAAKQQHKPVIELEGAENQIAMLLQLPDKGLALLD
DTLTHWHTNARLLQQMMSWWLNAPPQNNDITLPNTFSQSLYDVLMHQRNLAWRDKLRAMP
PGRYVVAVGALHLYGEGNLPQMLR