Protein Info for NOLOHH_00335 in Escherichia coli ECOR27

Annotation: type IV secretion system protein VirB5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF07996: T4SS" amino acids 22 to 218 (197 residues), 120.4 bits, see alignment E=6e-39

Best Hits

KEGG orthology group: K03200, type IV secretion system protein VirB5 (inferred from 58% identity to hde:HDEF_1333)

Predicted SEED Role

"Minor pilin of type IV secretion complex (VirB5)" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>NOLOHH_00335 type IV secretion system protein VirB5 (Escherichia coli ECOR27)
MKLNKYVLAIAIAYSSSVFSAGIPVVDAVGNAQELAHWTEKLKQWTETVQHYKSQLQAYK
DQLATATGIRDIQGLVAQGKSLKNDITNLQKQGISLDDLLTSGNAPTGALDSLYNRFKDF
DVCDARQAASYINLCKQETVNKAWALEQTTEVQEKISDALNDISNLTDRMANAKDIKESQ
DLANAVQAKSIQLNVLSQQWEMNMRASEQRDKLLKEKRKQAKQQSQIEASVADLN