Protein Info for NIAGMN_22375 in Escherichia coli ECRC102

Name: rfbE
Annotation: GDP-perosamine synthase RfbE/PerA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01041: DegT_DnrJ_EryC1
  • amino acids 12 to 357 (346 residues), 428 bits, E=5.2e-132
• PF00155: Aminotran_1_2
  • amino acids 36 to 154 (119 residues), 38.1 bits, E=1.7e-13
• PF00266: Aminotran_5
  • amino acids 54 to 162 (109 residues), 26.2 bits, E=5.8e-10

Best Hits

Swiss-Prot: 100% identical to GDPPS_ECO57: GDP-perosamine synthase (perA) from Escherichia coli O157:H7

KEGG orthology group: K13010, perosamine synthetase (inferred from 100% identity to ecs:ECs2841)

MetaCyc: 100% identical to GDP-perosamine synthase monomer (Escherichia coli O157:H7)
RXN-8953 [EC: 2.6.1.102]

Predicted SEED Role

"Perosamine synthetase Per"

MetaCyc Pathways

• GDP-N-acetyl-α-D-perosamine biosynthesis (3/3 steps found)
• GDP-D-perosamine biosynthesis (2/2 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (10/14 steps found)
• GDP-N-formyl-α-D-perosamine biosynthesis (2/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.102

Protein Sequence (364 amino acids)

>NIAGMN_22375 GDP-perosamine synthase RfbE/PerA (Escherichia coli ECRC102)
MKYIPVYQPSLTGKEKEYVNECLDSTWISSKGNYIQKFENKFAEQNHVQYATTVSNGTVA
LHLALLALGISEGDEVIVPTLTYIASVNAIKYTGATPIFVDSDNETWQMSVSDIEQKITN
KTKAIMCVHLYGHPCDMEQIVELAKSRNLFVIEDCAEAFGSKYKGKYVGTFGDISTFSFF
GNKTITTGEGGMVVTNDKTLYDRCLHFKGQGLAVHRQYWHDVIGYNYRMTNICAAIGLAQ
LEQADDFISRKREIADIYKKNINSLVQVHKESKDVFHTYWMVSILTRTAEEREELRNHLA
DKLIETRPVFYPVHTMPMYSEKYQKHPIAEDLGWRGINLPSFPSLSNEQVIYICESINEF
YSDK