Protein Info for NIAGMN_21390 in Escherichia coli ECRC102

Name: mdtQ
Annotation: multidrug resistance outer membrane protein MdtQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 46 to 505 (460 residues), 274.2 bits, see alignment E=1e-85 PF02321: OEP" amino acids 99 to 296 (198 residues), 62.7 bits, see alignment E=2.1e-21 amino acids 323 to 503 (181 residues), 48.6 bits, see alignment E=4.5e-17

Best Hits

Swiss-Prot: 100% identical to MDTQ_ECO57: Multidrug resistance outer membrane protein MdtQ (mdtQ) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to sfv:SFV_2214)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein, NodT family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>NIAGMN_21390 multidrug resistance outer membrane protein MdtQ (Escherichia coli ECRC102)
LLLMYCHAKLKNISQHTVISAHLFLPDYSPMNRDSFYPAIACFPLLLMLAGCAPMHETRQ
ALSQQTPAAQVDTALPTALKNGWPDSQWWLEYHDNQLTSLINNALQNAPDMQVAEQRIQL
AEAQAKAVATQDGPQIDFSADMERQKMSAEGLMGPFALNDPAAGTTGPWYTNGTFGLTAG
WHLDIWGKNRAEVTARLGTVKARAAEREQTRQLLAGSVARLYWEWQTQAALNTVLQQIEK
EQNTIIATDRQLYQNGITSSVEGVETDINASKTRQQLNDVAGKMKIIEARLIALTNHQTK
SLTLKPVALPKVASQLPDELGYSLLARRADLQAAHWYVESSLSTIDAAKAAFYPDINLMA
FLQQDALHLSDLFRHSAQQMGVTAGLTLPIFDSGRLNANLDIAKAESNLSIASYNKAVVE
AVNDVARAASQVQTLAEKNQHQAQIERDALRVVGLAQARFNAGIIAGSRVSEARIPALRE
RANGLLLQGQWLDASIQLTGALGGGYKR