Protein Info for NIAGMN_18550 in Escherichia coli ECRC102

Name: emrA
Annotation: multidrug efflux MFS transporter periplasmic adaptor subunit EmrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details TIGR00998: efflux pump membrane protein" amino acids 20 to 345 (326 residues), 491.9 bits, see alignment E=4e-152 PF00529: CusB_dom_1" amino acids 35 to 345 (311 residues), 68.2 bits, see alignment E=1e-22 PF16576: HlyD_D23" amino acids 61 to 289 (229 residues), 46.3 bits, see alignment E=6.6e-16 PF13533: Biotin_lipoyl_2" amino acids 61 to 108 (48 residues), 30.7 bits, see alignment 4.3e-11 PF13437: HlyD_3" amino acids 218 to 296 (79 residues), 46.4 bits, see alignment E=1.1e-15

Best Hits

Swiss-Prot: 100% identical to EMRA_ECOLI: Multidrug export protein EmrA (emrA) from Escherichia coli (strain K12)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to eco:b2685)

MetaCyc: 100% identical to multidrug efflux pump membrane fusion protein EmrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Multidrug resistance protein A (ErmA)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>NIAGMN_18550 multidrug efflux MFS transporter periplasmic adaptor subunit EmrA (Escherichia coli ECRC102)
MSANAETQTPQQPVKKSGKRKRLLLLLTLLFIIIAVAIGIYWFLVLRHFEETDDAYVAGN
QIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKAKTALASSVRQTHQQMI
NSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHARDAVTSAQAQLDVAIQQ
YNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIVSPMTGYVSRRAVQPGAQISPT
TPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGDDVKYTGKVVGLDMGTGSAF
SLLPAQNATGNWIKVVQRLPVRIELDQKQLEQYPLRIGLSTLVSVNTTNRDGQVLANKVR
STPVAVSTAREISLAPVNKLIDDIVKANAG